Loading...
Statistics
Advertisement

Technology, Business, People & Life | my inspirations
www.amulmago.com/
my inspirations

Amulmago.com

Advertisement
Amulmago.com is hosted in United States / San Francisco . Amulmago.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 0. Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Amulmago.com

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Amulmago.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 305824697402169823231304834028145237636840
    • validFrom: 160404105900Z
    • validTo: 160703105900Z
    • validFrom_time_t: 1459767540
    • validTo_time_t: 1467543540
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Amulmago.com

Number of occurences: 13
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width
  • Name: google-site-verification
    Content: networking
  • Name: msvalidate.01
    Content: networking
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #ffffff
  • Name: application-name
    Content: Technology, Business, People & Life
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: my inspirations
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Technology, Business, People & Life on WordPress.com
  • Name: description
    Content: my inspirations

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns1.wordpress.com
  • ns2.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sun, 10 Apr 2016 11:10:17 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://amulmago.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Sun, 10 Apr 2016 11:10:17 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: amulmago.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: amulmago.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: amulmago.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns3.wordpress.com
host: amulmago.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns1.wordpress.com
host: amulmago.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns2.wordpress.com
host: amulmago.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.mulmago.com, www.aomulmago.com, www.omulmago.com, www.apmulmago.com, www.pmulmago.com, www.a9mulmago.com, www.9mulmago.com, www.amulmago.com, www.mulmago.com, www.aimulmago.com, www.imulmago.com, www.aumulmago.com, www.umulmago.com, www.aulmago.com, www.ampulmago.com, www.apulmago.com, www.amoulmago.com, www.aoulmago.com, www.amiulmago.com, www.aiulmago.com, www.amkulmago.com, www.akulmago.com, www.am.ulmago.com, www.a.ulmago.com, www.amuulmago.com, www.auulmago.com, www.amjulmago.com, www.ajulmago.com, www.amnulmago.com, www.anulmago.com, www.am-ulmago.com, www.a-ulmago.com, www.amlmago.com, www.amuwlmago.com, www.amwlmago.com, www.amuelmago.com, www.amelmago.com, www.amuslmago.com, www.amslmago.com, www.amualmago.com, www.amalmago.com, www.amumago.com, www.amulumago.com, www.amuumago.com, www.amul8mago.com, www.amu8mago.com, www.amul9mago.com, www.amu9mago.com, www.amuljmago.com, www.amujmago.com, www.amul0mago.com, www.amu0mago.com, www.amulmmago.com, www.amummago.com, www.amulpmago.com, www.amupmago.com, www.amulomago.com, www.amuomago.com, www.amulago.com, www.amulmpago.com, www.amulpago.com, www.amulmoago.com, www.amuloago.com, www.amulmiago.com, www.amuliago.com, www.amulmkago.com, www.amulkago.com, www.amulm.ago.com, www.amul.ago.com, www.amulmuago.com, www.amuluago.com, www.amulmjago.com, www.amuljago.com, www.amulmnago.com, www.amulnago.com, www.amulm-ago.com, www.amul-ago.com, www.amulmgo.com, www.amulmaogo.com, www.amulmogo.com, www.amulmapgo.com, www.amulmpgo.com, www.amulma9go.com, www.amulm9go.com, www.amulmago.com, www.amulmgo.com, www.amulmaigo.com, www.amulmigo.com, www.amulmaugo.com, www.amulmugo.com, www.amulmao.com, www.amulmagso.com, www.amulmaso.com, www.amulmagxo.com, www.amulmaxo.com, www.amulmagyo.com, www.amulmayo.com, www.amulmagho.com, www.amulmaho.com, www.amulmagno.com, www.amulmano.com, www.amulmagco.com, www.amulmaco.com, www.amulmagdo.com, www.amulmado.com, www.amulmageo.com, www.amulmaeo.com, www.amulmagro.com, www.amulmaro.com, www.amulmagto.com, www.amulmato.com, www.amulmagbo.com, www.amulmabo.com, www.amulmagvo.com, www.amulmavo.com, www.amulmag.com, www.amulmagob.com, www.amulmagb.com, www.amulmagoh.com, www.amulmagh.com, www.amulmagog.com, www.amulmagg.com, www.amulmagoj.com, www.amulmagj.com, www.amulmagom.com, www.amulmagm.com, www.amulmago .com, www.amulmag .com, www.amulmagov.com, www.amulmagv.com,

Other websites we recently analyzed

  1. KIDS CORNER キッズコーナー Tokyo Japan
    Osaka (Japan) - 59.106.27.202
    Server software: Apache/2.2.31
    Technology: CSS, Html, Iframe, Javascript, Swf Object
    Number of Javascript: 4
    Number of meta tags: 3
  2. Itehalka Online Store
    Online Departmental Store
    Tempe (United States) - 198.15.116.243
    G Analytics ID: UA-82079839-1
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 3
  3. Collaborative Infrastructure Services, Inc. |
    Provo (United States) - 198.57.242.90
    Server software: nginx/1.10.1
    Technology: CSS, Fancybox, Flexslider, Google Font API, Html, Javascript, jQuery, Php, Pingback, Shortcodes, SuperFish, Wordpress
    Number of Javascript: 9
    Number of meta tags: 3
  4. 桂林富盛物流有限公司|桂林物流|桂林货运|桂林南京专线||桂林物流公司|桂林合肥专线|桂林无锡专线
    Beijing (China) - 182.61.24.187
    Server software: nginx/1.0.15
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 3
    Number of meta tags: 1
  5. Green Bean MineCraft
    Frankfurt (Germany) - 149.126.77.133
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Google Font API, Html5
    Number of Javascript: 4
    Number of meta tags: 3
  6. Ostermann-hh
    Germany - 5.159.56.6
    Server software: Apache/2.2.22 (FreeBSD) mod_fcgid/2.3.6 mod_ssl/2.2.22 OpenSSL/0.9.8q
    Technology: Html
    Number of meta tags: 4
  7. Отдел Продаж N1
    Latvia - 195.130.205.130
    Server software: nginx
    Technology: CloudFront, DoubleClick.Net, CSS, Html, Iframe, Javascript, jQuery, Yandex.Metrika, Google Tagmanager
    Number of Javascript: 3
    Number of meta tags: 4
  8. DREAMALIZE - HOME
    San Francisco (United States) - 199.34.228.59
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 9
    Number of meta tags: 2
  9. Mes Envies Shopping
    France - 91.121.143.185
    Server software: Apache
    Technology: CSS, Html, Php
  10. Costa Blanca Ferien - Ferienhäuser an der Costa Blanca in Spanien
    Costa Blanca Ferienhäuser und Ferienwohnungen an der Costa Blanca in Spanien. Ferienhäuser in Moraira Calpe Javea Benissa Denia.
    Dublin (Ireland) - 54.72.98.16
    Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.9
    Technology: CSS, Html, Html5, Javascript, Php
    Number of Javascript: 11
    Number of meta tags: 5

Check Other Websites